DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3GNT2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001306004.1 Gene:B3GNT2 / 10678 HGNCID:15629 Length:397 Species:Homo sapiens


Alignment Length:339 Identity:93/339 - (27%)
Similarity:149/339 - (43%) Gaps:78/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIVPR-DFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSV 106
            :|.:|::.: |.|..|..|::|:.|...||.:|.|||::||...:......||            
Human   126 RNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVR------------ 178

  Fly   107 MPGRLKLYSMYLSGLDDSLTAKIRIVFILGRS-KNDSKREL-DKLFRESIQHNDIIQENFVDSYH 169
                                     ||:||:: ..|:..:| |.|..||.:|.||:..|:.|::.
Human   179 -------------------------VFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFF 218

  Fly   170 NLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVK 234
            ||:||.|:.|:.:|.||.| ..|..|.|||.|||..::|::|              :|.:..|.|
Human   219 NLSLKEVLFLRWVSTSCPD-TEFVFKGDDDVFVNTHHILNYL--------------NSLSKTKAK 268

  Fly   235 SPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAE 299
            .          |..|....|.....|.|..:|:|..::.|. ||.|..|.|:|.|..:..|||. 
Human   269 D----------LFIGDVIHNAGPHRDKKLKYYIPEVVYSGL-YPPYAGGGGFLYSGHLALRLYH- 321

  Fly   300 ALTTSLVHL---EDVFVTGICAKKAG-IRRRHQPLFNY----VHGKPLCIFKGTITMHPVPLHSM 356
              .|..|||   :||: ||:|.:|.| :..:|:....:    .:...:|.:...:.:|......|
Human   322 --ITDQVHLYPIDDVY-TGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEM 383

  Fly   357 LDAWAFVSNYSIKC 370
            :|.|:.:.:..:||
Human   384 IDIWSQLQSAHLKC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 76/262 (29%)
B3GNT2NP_001306004.1 Galactosyl_T 156..345 CDD:389837 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.