DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3GNT3

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_055071.2 Gene:B3GNT3 / 10331 HGNCID:13528 Length:372 Species:Homo sapiens


Alignment Length:337 Identity:78/337 - (23%)
Similarity:142/337 - (42%) Gaps:84/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKL 113
            ||...|.....|::.:.|...::.:|..:|:|||..:.                           
Human    98 VPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERK--------------------------- 135

  Fly   114 YSMYLSGLDDSLTAKIRIVFILGRSKNDSK-RELDKLFR-ESIQHNDIIQENFVDSYHNLTLKSV 176
                :.||      ::|::|::|.:.|..: |::::|.. |:..|.||:|.:|.||:.|||||.|
Human   136 ----VRGL------QLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQV 190

  Fly   177 MALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLN 241
            :.|:.....||: |:|.|..|||.|.:..|::.:|        :|    |              :
Human   191 LFLQWQETRCAN-ASFVLNGDDDVFAHTDNMVFYL--------QD----H--------------D 228

  Fly   242 GSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLV 306
            ..|.|..|....|:..:....|.:|:|..:.:..:||.|..|.|:|:|......|...|....:.
Human   229 PGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIF 293

  Fly   307 HLEDVFVTGIC-------------AKKAGIRRRHQPLFNYVHGKPLCIFKGTITMHPVPLHSMLD 358
            .::|||: |:|             .:.:|:|...|.|.::   .| |.::..:.:|....:.||.
Human   294 PIDDVFL-GMCLELEGLKPASHSGIRTSGVRAPSQRLSSF---DP-CFYRDLLLVHRFLPYEMLL 353

  Fly   359 AWAFVSNYSIKC 370
            .|..::..::.|
Human   354 MWDALNQPNLTC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 64/271 (24%)
B3GNT3NP_055071.2 Galactosyl_T 122..311 CDD:389837 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.