DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and B3GALT5

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_149362.2 Gene:B3GALT5 / 10317 HGNCID:920 Length:314 Species:Homo sapiens


Alignment Length:356 Identity:90/356 - (25%)
Similarity:157/356 - (44%) Gaps:90/356 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PLKIGDYLDQGKNTALIVPRDFCK-SKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRL 95
            |.|...::.:.....|.:|...|: :...||:.|.|......:|.|||||||..:.         
Human    34 PFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERM--------- 89

  Fly    96 HGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSK-RELDKLFRESIQHNDI 159
               ::||                         :::..|:||.:.:.:: :|:|   :||.:|.||
Human    90 ---VKGK-------------------------QLKTFFLLGTTSSAAETKEVD---QESQRHGDI 123

  Fly   160 IQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLL--GGTIPLYKDT 222
            ||::|:|.|:|||||::|.::.:.:.| .:|||.:|.|.|.|:||..|...||  ..|...:   
Human   124 IQKDFLDVYYNLTLKTMMGIEWVHRFC-PQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFF--- 184

  Fly   223 VGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYL 287
            .|:.....:.::.|:                         |.|::....:...:||.:.|||||:
Human   185 TGFLKLNEFPIRQPF-------------------------SKWFVSKSEYPWDRYPPFCSGTGYV 224

  Fly   288 MSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLFNYVHGKP----------LCIF 342
            .|.||..::|..:.:...:.|||||| |:|.::..||      ...:|.:|          :|:|
Human   225 FSGDVASQVYNVSKSVPYIKLEDVFV-GLCLERLNIR------LEELHSQPTFFPGGLRFSVCLF 282

  Fly   343 KGTITMHPVPLHSMLDAWAFVSNYSIKCLPP 373
            :..:..|.:...::||.|..:.|...:..||
Human   283 RRIVACHFIKPRTLLDYWQALENSRGEDCPP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 70/259 (27%)
B3GALT5NP_149362.2 Galactosyl_T 75..265 CDD:304462 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.