DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3galt4

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_005167417.1 Gene:b3galt4 / 101886595 ZFINID:ZDB-GENE-081104-482 Length:372 Species:Danio rerio


Alignment Length:321 Identity:83/321 - (25%)
Similarity:131/321 - (40%) Gaps:87/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLS 119
            ::|..|:..|.:...:.:.|.|||.|||       || |.:.||                     
Zfish    90 RAKPYLITLVATAPPNRKARQAIRDTWG-------GE-VHVRGH--------------------- 125

  Fly   120 GLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQ 184
                    ::..:|::|:..:....:  :|..||.:..|:||..|.|:|.|||||::..|....:
Zfish   126 --------RVMTLFVVGQPTDPVIGK--ELIEESKERGDLIQGRFTDTYTNLTLKTLSILGWARR 180

  Fly   185 SCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVG----YHSRTTYKV---KSPWNRLNG 242
            .| .:|.:..|.|||...|...||.:|   .:...:|...    |..|...:|   ::|.:|   
Zfish   181 FC-PQAHYVAKVDDDVMFNPNALLQYL---NLSFKRDESELLELYLGRVHMQVAPDRNPASR--- 238

  Fly   243 SRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSL-- 305
                   |               :|....:.|...|.|.|||.|::|...:.:|...|:..:|  
Zfish   239 -------H---------------FMSETAYAGMVLPDYCSGTAYVLSRSALLKLSLAAVAINLPK 281

  Fly   306 -VHLEDVFVTGICAKKAGIRRRHQPLFNYVHGKPL-----CIFKGTITMHPVPLHSMLDAW 360
             :..||||| ||||..|||...|.|.|:   |.|.     |.::..:::|.....:||:.|
Zfish   282 PLPPEDVFV-GICAHTAGINPTHSPFFS---GGPAVPYSRCCYQTMVSVHHTTPANMLNYW 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 71/266 (27%)
b3galt4XP_005167417.1 Galactosyl_T 107..305 CDD:304462 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.