DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and LOC101882239

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_017206852.2 Gene:LOC101882239 / 101882239 -ID:- Length:388 Species:Danio rerio


Alignment Length:348 Identity:92/348 - (26%)
Similarity:155/348 - (44%) Gaps:89/348 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 REKPLKIGDYLDQGKNTALIVPRDFCKSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFV 93
            :::|.|   |:....|..|:       ....||:.:.......:.|.|||:||||          
Zfish   109 KDEPYK---YIHNEPNACLL-------RAPFLVLLIAVEPKKSDARDAIRKTWGN---------- 153

  Fly    94 RLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIV--FILGRSK----NDSKRELDKLFRE 152
                                         :||..::.::  |::|.:|    |..|.:| .:..|
Zfish   154 -----------------------------ESLAGELGVIRLFLIGVNKDTQSNGGKLQL-SIEDE 188

  Fly   153 SIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIP 217
            |.||:||||:::.|||.|||||::|.:..|::.|.: |.:.:|.|.|.|||...|:|.:|     
Zfish   189 SRQHHDIIQQDYRDSYKNLTLKTLMGMYWITKYCPE-AMYVMKTDSDMFVNTEYLIHQIL----- 247

  Fly   218 LYKDTVGYHSRTTYKVKSPWNRLNG-SRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYL 281
                                 :.|| .|....|:...:.....:::|.||||..::...:||.:.
Zfish   248 ---------------------KPNGQERKYFTGYLMMDFSPNRNIRSKWYMPPELYPDRRYPNFC 291

  Fly   282 SGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIR---RRHQPLFNYVH-GKPLCIF 342
            |||||:.|.|:.:|:|..:|:...:|||||:| |||..|.||:   :.::.:||:.. ....|.:
Zfish   292 SGTGYVFSGDMAQRIYVASLSIPRLHLEDVYV-GICLAKLGIKPVPQTNKKVFNHWRVSYSSCKY 355

  Fly   343 KGTITMHPVPLHSMLDAWAFVSN 365
            ...:|.|....:.::..|..:.|
Zfish   356 SNLVTSHGFHPNELIQYWKHLQN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 78/266 (29%)
LOC101882239XP_017206852.2 Galactosyl_T 142..336 CDD:250845 78/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.