DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and LOC101734599

DIOPT Version :10

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_004920925.2 Gene:LOC101734599 / 101734599 XenbaseID:XB-GENE-29087915 Length:315 Species:Xenopus tropicalis


Alignment Length:38 Identity:9/38 - (23%)
Similarity:17/38 - (44%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KHTVKFKDQARDDVLV-VTVEPPSPSPGSPEPSPKTAV 61
            :.:::|.|.......| :..:||:..||......:.||
 Frog   337 RRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:473923
LOC101734599XP_004920925.2 Galactosyl_T 72..259 CDD:473923
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.