DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3galt5.2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_012813706.2 Gene:b3galt5.2 / 100494668 XenbaseID:XB-GENE-992036 Length:311 Species:Xenopus tropicalis


Alignment Length:314 Identity:92/314 - (29%)
Similarity:139/314 - (44%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIVPRDFC-KSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSV 106
            :.|..:.|:..| ::...||:.|.:.....|:|:.||||||..         ||.|.        
 Frog    45 RETFQLRPKVQCERNPPFLVLLVTTNHSQKEERNVIRQTWGKE---------RLIGD-------- 92

  Fly   107 MPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNL 171
                 ||.|.|               |:||...|...:|  :|..||..:|||||.:|:|||:||
 Frog    93 -----KLVSTY---------------FLLGAGTNPRLQE--ELIEESNTYNDIIQRDFIDSYYNL 135

  Fly   172 TLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSP 236
            |||::|.::.|...| .:..|.:|.|.|.|||...|:..|:                        
 Frog   136 TLKTIMGIEWICTHC-PQTTFVMKTDTDMFVNPLYLVELLV------------------------ 175

  Fly   237 WNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEAL 301
              :.|.:..|..|....:...:.|:.|.||:....:..||||.:.|||||:.|:||.:|:...:.
 Frog   176 --KKNQTTDLFTGSLRLHDAPIRDINSKWYISTAEYPQAKYPPFCSGTGYVFSVDVAQRIQNVSS 238

  Fly   302 TTSLVHLEDVFVTGICAKK--AGIRRRHQPLFNYVHGKP--LCIFKGTITMHPV 351
            |.....||||:| |:|.:|  ..::..|.....|.:.||  :|.::..:|.|.|
 Frog   239 TVPFFKLEDVYV-GMCLEKLEINLQNLHTETTFYAYKKPFTVCNYRKLVTSHGV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 79/258 (31%)
b3galt5.2XP_012813706.2 Galactosyl_T 77..265 CDD:419759 77/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9490
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.