DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3galt5.1

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_002938778.1 Gene:b3galt5.1 / 100494507 XenbaseID:XB-GENE-992040 Length:314 Species:Xenopus tropicalis


Alignment Length:324 Identity:94/324 - (29%)
Similarity:142/324 - (43%) Gaps:74/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIVPRDFC-KSKALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSV 106
            :.|..:.|:..| ::...||:.|.:.....|.|:.||||||..         ||.|.        
 Frog    48 RETFQLRPKIQCERNPPFLVLLVTTTHSQKEARNVIRQTWGKE---------RLIGD-------- 95

  Fly   107 MPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNL 171
                 ||.|.|               |:||...|  .|...:|..||..:|||||.:|:|||:||
 Frog    96 -----KLVSTY---------------FLLGAGTN--PRLQGELTGESNTYNDIIQRDFIDSYYNL 138

  Fly   172 TLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSP 236
            |||::|.::.|...| .:..|.:|.|.|.|||             |||...:......|..|.:.
 Frog   139 TLKTIMGIEWICTHC-PQTTFVMKTDTDMFVN-------------PLYLVELLVKKNQTTDVFTG 189

  Fly   237 WNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEAL 301
            ..||:.:             .:.:..|.:|:....:..||||.:.|||||:.|:||.:::...:.
 Frog   190 SLRLHDA-------------PIRNNHSKYYISTTEYPLAKYPPFCSGTGYVFSVDVAQKIQNVSS 241

  Fly   302 TTSLVHLEDVFVTGICAKKAGIRRRH---QPLFNYVHGKP--LCIFKGTITMHPVPLHSMLDAW 360
            |.....|||||| |:|.:|..|..::   :|.| :.:.||  :|.::..:|.|.|....:...|
 Frog   242 TVPFFKLEDVFV-GMCLEKVNINLQNLHTKPTF-HAYKKPFTICNYRKLVTSHGVRPRELYLFW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 79/259 (31%)
b3galt5.1XP_002938778.1 Galactosyl_T 78..268 CDD:389837 79/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.