DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3galt9

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_002935272.1 Gene:b3galt9 / 100487553 XenbaseID:XB-GENE-6044171 Length:372 Species:Xenopus tropicalis


Alignment Length:345 Identity:85/345 - (24%)
Similarity:144/345 - (41%) Gaps:86/345 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DQGKNTAL-IVPRDFCKSKALLVIAVCSGLDHF------------EQRSAIRQTWGNTKSFNYGE 91
            :|.:|..: ::.::..:|..:....:|||.|.|            .:|..||:||||..  ||.:
 Frog    55 EQARNLNMQLLKKNISESYVIREEGLCSGRDVFLLMVVSSSPENKTRRDTIRRTWGNMT--NYKD 117

  Fly    92 FVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDSKRELDKLFRESIQH 156
            .|.:.                                   :|.|||..::..:.  :|..||..|
 Frog   118 LVVVR-----------------------------------MFALGRPTSEETQA--ELLVESQVH 145

  Fly   157 NDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKD 221
            .|:::.:|:|:|.|.|||.:.:::.|...|.: |.|.||.|.:.||||.:|:.:|      .|..
 Frog   146 KDMVEASFLDTYENRTLKVITSMEWIVTFCPN-ARFILKVDQEAFVNVESLVDYL------SYLL 203

  Fly   222 TVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDD--VKSPWYMPYYMFKGAKYPKYLSGT 284
            |:...|...|.          .|.:..|        |.|  .||..::|...:..|.||.|.|||
 Frog   204 TLERRSEDVYI----------GRVIHQG--------VPDREPKSLHFVPTSSYPDAFYPDYCSGT 250

  Fly   285 GYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLF----NYVHGKPLCIFKGT 345
            ..::|.||.:::|..:...:.:...|||: |:||:|||:...|...|    :..:.:  |.::..
 Frog   251 ALVISQDVARKVYLVSKDETTLLPPDVFL-GMCARKAGVVPVHSSRFSGPKHITYNR--CCYRFI 312

  Fly   346 ITMHPVPLHSMLDAWAFVSN 365
            .:...|....:...|..:||
 Frog   313 FSSSSVGEEELSFLWRDMSN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 71/258 (28%)
b3galt9XP_002935272.1 Galactosyl_T 101..292 CDD:389837 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.