DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and LOC100331460

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_002667105.2 Gene:LOC100331460 / 100331460 -ID:- Length:370 Species:Danio rerio


Alignment Length:323 Identity:89/323 - (27%)
Similarity:138/323 - (42%) Gaps:80/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDS 124
            :|:.|.:..:..|.|:|||.||||..:            ::||         .:.:::|.||   
Zfish   120 VVLMVPAAPNQIEARNAIRSTWGNETT------------VQGK---------AVLTLFLVGL--- 160

  Fly   125 LTAKIRIVFILGRSKNDSKRELDKLFRESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADR 189
                     .:|   .||::...:|..||.||.|:||.||||||.|||:|:::.:..::..| .:
Zfish   161 ---------TVG---GDSEKAQQQLEEESRQHRDLIQSNFVDSYFNLTIKTMVMMDWLATRC-PQ 212

  Fly   190 AAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCN 254
            |.:.:|.|.|.|:||.||:.|||....|          |..|               :.|....|
Zfish   213 ATYAIKIDTDMFLNVENLMTFLLAPNTP----------RENY---------------LTGVLLWN 252

  Fly   255 MKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAK 319
            ...|.:..|.||:...|:....||.|..||||:.|.|:.:::...:......::||.:: |.|.|
Zfish   253 RPVVRNKNSKWYVSEDMYPDLTYPTYPLGTGYVFSNDLPEKIVEISKEVQAFNIEDAYI-GACLK 316

  Fly   320 KAGIRRRHQP---LF----NYVHGKPLCIFKGTITMHPVPLHSMLDAWAFVSNYSIKCLPPRK 375
            :.|......|   ||    .|...:.|.|. .|....|   ..:|:.|..|.:      ||:|
Zfish   317 RLGFEPSSPPDPSLFRIYMTYNREEFLKII-STDVGSP---QQILNIWKDVKS------PPKK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 73/256 (29%)
LOC100331460XP_002667105.2 Galactosyl_T 132..326 CDD:304462 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.