DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and b3gnt2

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001123810.1 Gene:b3gnt2 / 100170561 XenbaseID:XB-GENE-957599 Length:397 Species:Xenopus tropicalis


Alignment Length:372 Identity:96/372 - (25%)
Similarity:157/372 - (42%) Gaps:99/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KAELSGWEREKPLKIGD--YLDQGKNTALIVPR-DFCKSKALLVIAVCSGLDHFEQRSAIRQTWG 82
            :|||..:: :.|.:..|  |..:.||.:|::.: :.|..|..|::|:.|.:..|::|.|||::||
 Frog   103 RAELKDFD-QLPDRFKDFFYYLRCKNYSLLLDQPNKCVDKPFLLLAIKSLIPQFDRRQAIRESWG 166

  Fly    83 NTKSFNYGEFVRLHGHLEGKYLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRS-KNDSKREL 146
            .....|....||                                     ||:||.: ..|:..:|
 Frog   167 KELKINNMTVVR-------------------------------------VFLLGETPPEDNYPDL 194

  Fly   147 DKLFR-ESIQHNDIIQENFVDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHF 210
            ..:.: ||..|.||:..|:.||:.|||||.|:.|:..|.||:. |.|..|.|||.|||.|.:|.:
 Frog   195 SGMVKFESEIHKDILLWNYKDSFFNLTLKEVLFLRWASHSCSS-AQFIFKGDDDVFVNTPLILDY 258

  Fly   211 L------------LGGTIPLYKDTVGYHSRTTYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKS 263
            |            :|..|   || .|.|...|.|                               
 Frog   259 LKTLSPEKAKDLFIGDVI---KD-AGPHREKTLK------------------------------- 288

  Fly   264 PWYMPYYMFKGAKYPKYLSGTGYLMSIDVVKRLYAEALTTSLVHLEDVFVTGICAKKAGIR-RRH 327
             :|:|..::.|: ||.|..|.|:|.|..|.:|||.......:..::||: ||:|.:|.|:. .:|
 Frog   289 -YYIPESIYVGS-YPPYAGGGGFLYSGSVAQRLYNATSRVLIYPIDDVY-TGMCLEKIGVSPEKH 350

  Fly   328 QPLFNY----VHGKPLCIFKGTITMHPVPLHSMLDAWAFVSNYSIKC 370
            :....:    ...|.:|.:...:.:||.....::..|:.:.:..:.|
 Frog   351 KGFKTFDIDEKQKKSICSYTNIMLVHPRKPQEIITIWSRLQDSQLNC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 75/271 (28%)
b3gnt2NP_001123810.1 Galactosyl_T 156..348 CDD:389837 74/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.