DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30036 and si:dkey-175m17.6

DIOPT Version :9

Sequence 1:NP_725096.2 Gene:CG30036 / 246408 FlyBaseID:FBgn0050036 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_005161436.1 Gene:si:dkey-175m17.6 / 100007286 ZFINID:ZDB-GENE-091204-392 Length:441 Species:Danio rerio


Alignment Length:347 Identity:91/347 - (26%)
Similarity:142/347 - (40%) Gaps:71/347 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KNTALIVPR-DFCKSK----ALLVIAVCSGLDHFEQRSAIRQTWGNTKSFNYGEFVRLHGHLEGK 102
            ::.|::|.: |.|..:    ..|::|:.|.:.:||.|.|||:|||.:.....|...|  |.|   
Zfish   151 RHYAILVDQPDLCAGQDSETPFLLMAIKSQIGNFENRQAIRETWGKSGPIQEGGGGR--GWL--- 210

  Fly   103 YLSVMPGRLKLYSMYLSGLDDSLTAKIRIVFILGRSKNDS--KRELDKLFR-ESIQHNDIIQENF 164
                                      :|.||:|.|...::  ..:|:.|.: ||..|.||:..:|
Zfish   211 --------------------------VRTVFLLARQDTETGPHPDLNALLKLESSTHKDILLWDF 249

  Fly   165 VDSYHNLTLKSVMALKHISQSCADRAAFFLKCDDDTFVNVPNLLHFLLGGTIPLYKDTVGYHSRT 229
            .||:.|||||.|:....:|:.| .:..|..|.|||.||....||.:|         |.:...   
Zfish   250 KDSFFNLTLKDVLFWNWLSKHC-PQVHFIFKGDDDVFVRTKALLDYL---------DQIRVE--- 301

  Fly   230 TYKVKSPWNRLNGSRGLMYGHKFCNMKTVDDVKSPWYMPYYMFKGAKYPKYLSGTGYLMSIDVVK 294
                |:..|:..|....:.|....|........:.:|:|...:||. ||.|..|.|.:.|..:..
Zfish   302 ----KTRGNKTKGLVDFVVGDVIANAWPNRQPNTKYYIPESFYKGT-YPTYPGGGGVVYSGALAM 361

  Fly   295 RLYAEALTTSLVHLEDVFVTGICAKKAGIRRRHQPLF------NYVHGKPLCIFKGTITMHPVPL 353
            ||...:...||..::|||: |:|..:.|:...|...|      ..|..|| |.:...:.:|....
Zfish   362 RLQEVSRWVSLFPIDDVFL-GMCLHRLGVPPTHHSGFLTFDLPEDVRDKP-CAYHNVLLVHRRTP 424

  Fly   354 HSMLDAWAFVSNYSIKCLPPRK 375
            ..||..|..:.      :||.:
Zfish   425 KEMLTLWKELQ------VPPHE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30036NP_725096.2 Galactosyl_T 72..329 CDD:304462 72/259 (28%)
si:dkey-175m17.6XP_005161436.1 Galactosyl_T 187..393 CDD:304462 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592624
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.