DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and zgc:153968

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:269 Identity:91/269 - (33%)
Similarity:141/269 - (52%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTV--PEGLLPQLD--------GRIVGGSATTISSFPWQISLQ--RSGSHSCGG 58
            ::|....|..|..:  ..|.|.|||        .||:||......|:|||:|:.  .:|...|||
Zfish     1 MMLRLAVCVAGVLLLNISGSLCQLDVCGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGGLLCGG 65

  Fly    59 SIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG---VTFSVSSFKNHEGYNANTMVNDIAII 120
            ::.:...:::||.|.|.::||.|.:..|  :.|:|.   :....|...||..|::.|..||||::
Zfish    66 TLINREWVLSAAQCFQKLTASNLVVHLG--HLSTGDPNVIHNPASQIINHPKYDSATNKNDIALL 128

  Fly   121 KINGALTFSSTIKAIGLASSNPA--NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASS 183
            |::..::|:..||.:.|.:|..:  .||.:.::|||:::.|.:..|:.||.|.:.:||...|.|:
Zfish   129 KLSTPVSFTDYIKPVCLTASGSSLGKGAVSWITGWGSINTGGTQFPTTLQEVKIPVVSNGDCKSA 193

  Fly   184 TYGYGSQIRSTMICAAAS--GKDACQGDSGGPLVSGG----VLVGVVSWGYGCAYSNYPGVYADV 242
               |||.|...||||..:  ||..|.||.|||||...    :..|:.|:|.|||....|||:..|
Zfish   194 ---YGSLITDGMICAGPNEGGKGICMGDGGGPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTRV 255

  Fly   243 AALRSWVIS 251
            :...||:.|
Zfish   256 SEYESWIKS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 81/231 (35%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 81/231 (35%)
Tryp_SPc 36..265 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.