DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and CG34458

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:258 Identity:94/258 - (36%)
Similarity:140/258 - (54%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            ::|..|||.||.     .|...:....:.||:||.......||.|:|||.:|.|.||||:.|..:
  Fly     7 LVKLSILLLAVT-----FVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTM 66

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSG-GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
            |||||||....:...::...|::..|:| |.||:::.|..|..||..:...|:::||::..:...
  Fly    67 IVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMG 131

  Fly   130 STIKAIGLA--SSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            ..::.|.||  .||.|....|.:||:|.::. :..:|::|::..|.:.|:..|.|...   ..:.
  Fly   132 GAVQTIQLADSDSNYAADTMAMISGFGAINQ-NLQLPNRLKFAQVQLWSRDYCNSQNI---PGLT 192

  Fly   193 STMICAA-ASGK-DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISNA 253
            ..|:||. .||: .:|||||||||...|.|.||||||:||.....|.:|..|.|||||:..||
  Fly   193 DRMVCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 84/223 (38%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 84/223 (38%)
Tryp_SPc 32..254 CDD:238113 84/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452427
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.