DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Klk4

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:226 Identity:72/226 - (31%)
Similarity:106/226 - (46%) Gaps:8/226 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS 91
            :..||:.|...:..|.|||.:|.......|.|.:.....:::||||||......|.:........
Mouse    28 VSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQESYIVGLGLHNLKGSQE 92

  Fly    92 SGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTL 156
            .|...........|..:|..:..||:.:||:|.::..|:||::|.:|:..|..|....|||||.|
Mouse    93 PGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSGWGQL 157

  Fly   157 SYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA--SGKDACQGDSGGPLVSGGV 219
            ..|  .:||.||.||:::.|:..|...   |......:|.||..  ..||:|.||||||:|....
Mouse   158 KNG--KLPSLLQCVNLSVASEETCRLL---YDPVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRS 217

  Fly   220 LVGVVSWGYG-CAYSNYPGVYADVAALRSWV 249
            |.|:||.|.| |.....|.||.::....:|:
Mouse   218 LQGLVSMGQGKCGQPGIPSVYTNLCKFTNWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 71/221 (32%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 71/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.