DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and AZU1

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:260 Identity:77/260 - (29%)
Similarity:116/260 - (44%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            |.:..:|  |:...|..:...|..|.||  ||||.......||:..|:|..|.|.|||::..:..
Human     1 MTRLTVL--ALLAGLLASSRAGSSPLLD--IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARF 61

  Fly    66 IVTAAHCLQSVSASVLQIRAGS----SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKIN--G 124
            ::|||.|.||.:..|..:..|:    ........|||:||. :..||:....:||:.:::::  .
Human    62 VMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSM-SENGYDPQQNLNDLMLLQLDREA 125

  Fly   125 ALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGS--SSIPSQLQYVNVNIVSQSQCASSTYGY 187
            .||.|.||..:.|.::....|....|:|||:...|.  |..|   ::|||.:..:.||       
Human   126 NLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFP---RFVNVTVTPEDQC------- 180

  Fly   188 GSQIRSTMICAAASGK--DACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAALRSWV 249
                |...:|.....:  ..|.||.|.|||..|:..||.|:..| |...  |..:..||..|.|:
Human   181 ----RPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRG--PDFFTRVALFRDWI 239

  Fly   250  249
            Human   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 68/229 (30%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 69/230 (30%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.