DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Klk11

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:263 Identity:80/263 - (30%)
Similarity:125/263 - (47%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            |:..:|.|:.|...:||          :.||:.|......|.|||::|.:.....||.::.:...
Mouse    28 MILRLIALALVTGHVGG----------ETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKW 82

  Fly    66 IVTAAHCLQS-----VSASVLQIRAGSSYWSSGGVTFSVSSF------KNHEGYNANTMVNDIAI 119
            ::|||||.:.     :....|:...|.........:|....|      |:|.        |||.:
Mouse    83 LLTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNKDHR--------NDIML 139

  Fly   120 IKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASST 184
            :|::..:.|:..::.:.|:....|.|.:..:|||||.|.....:|..|:..||:|:...:|..: 
Mouse   140 VKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIEHKECEKA- 203

  Fly   185 YGYGSQIRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAALR 246
              |...|..||:||:.  .|||:||||||||||..|.|.|::|||.. ||.:..||||..|....
Mouse   204 --YPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYF 266

  Fly   247 SWV 249
            :|:
Mouse   267 NWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 73/232 (31%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 73/232 (31%)
Tryp_SPc 48..272 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.