DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and PRSS2

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:264 Identity:100/264 - (37%)
Similarity:144/264 - (54%) Gaps:27/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :..:::|:.||.|:.....:      |.:||||.....:|.|:|:|| .||.|.||||:.|...:
Human     1 MNLLLILTFVAAAVAAPFDD------DDKIVGGYICEENSVPYQVSL-NSGYHFCGGSLISEQWV 58

  Fly    67 VTAAHCLQSVSASVL----------QIRAGSSYWS--SGGVTF-SVSSFKNHEGYNANTMVNDIA 118
            |:|.||.:|...|.|          |:|.|.....  .|...| :.:....|..||:.|:.|||.
Human    59 VSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDIL 123

  Fly   119 IIKINGALTFSSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCAS 182
            :||::.....:|.:.||.|.::.||.|..:.:|||| |||.| :..|.:||.::..::||::|.:
Human   124 LIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSG-ADYPDELQCLDAPVLSQAECEA 187

  Fly   183 STYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAAL 245
            |   |..:|.:.|.|..  ..|||:||||||||:||.|.|.|:||||||||..|.||||..|...
Human   188 S---YPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNY 249

  Fly   246 RSWV 249
            ..|:
Human   250 VDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 94/234 (40%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 94/234 (40%)
Tryp_SPc 24..256 CDD:238113 95/235 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.