DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and PRSS1

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:250 Identity:91/250 - (36%)
Similarity:134/250 - (53%) Gaps:19/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :::|:.||.||.....:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:|:|
Human   229 LLILTFVAAALAAPFDD------DDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSLINEQWVVSA 286

  Fly    70 AHCLQSVSASVLQIRAGSSYWS--SGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            .||.:    |.:|:|.|.....  .|...| :.:....|..|:..|:.|||.:||::.....::.
Human   287 GHCYK----SRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINAR 347

  Fly   132 IKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMI 196
            :..|.|.::.||.|....:||||..:...:..|.:||.::..::||::|.:|   |..:|.|.|.
Human   348 VSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEAS---YPGKITSNMF 409

  Fly   197 CAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |..  ..|||:||||||||:|..|.|.||||||.|||..|.||||..|.....|:
Human   410 CVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 84/223 (38%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 84/223 (38%)
Tryp_SPc 249..467 CDD:238113 85/223 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.