DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and zgc:112038

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:250 Identity:81/250 - (32%)
Similarity:133/250 - (53%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLLPQLD--GRIV-----GGSATTISSFPWQISLQRSG--SHSCGGSIYSSNVIVTAAHCLQSVS 77
            |.|.|||  |:..     ||......|:|||.|:.|..  .|.||||:.:.:.:::||||....:
Zfish    19 GALCQLDVCGQAPLNNNNGGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITA 83

  Fly    78 ASVLQIRAGSSYWSSGG---VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLAS 139
            .:.::|..|..:.:...   ::.:::....|..|:..|..||||:::::.::||:..|:.:.|||
Zfish    84 TANIKIFLGRQFQTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLAS 148

  Fly   140 SNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAAS- 201
            ::.  |.|..:.::||.........:.:.||.|.:.:||.::|.:.   |...|...||||..: 
Zfish   149 ADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNAD---YKGIITDNMICAGINE 210

  Fly   202 -GKDACQGDSGGPLVSGG----VLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
             ||||||||||||:||..    :..|:||:|..|....|||:|..|:..:||:.|
Zfish   211 GGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 73/236 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 73/228 (32%)
Tryp_SPc 37..263 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.