DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and prss1

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:254 Identity:103/254 - (40%)
Similarity:149/254 - (58%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :||:|:|..:..|:..        :.|.:||||...|.::.|:|:|| .:|.|.||||:.:|..:
 Frog     1 MKFLIVLVLLGAAVAF--------EDDDKIVGGFTCTKNAVPYQVSL-NAGYHFCGGSLINSQWV 56

  Fly    67 VTAAHCLQSVSASVLQIRAGS-SYWSSGGVTFSVSSFK--NHEGYNANTMVNDIAIIKINGALTF 128
            |:||||.:    |.:|:|.|. :...:.|....:.|.|  .|..||:..:.|||.:||::.....
 Frog    57 VSAAHCYK----SRIQVRLGEHNIAVNEGTEQFIESQKVIKHPSYNSRNLDNDIMLIKLSTTARL 117

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            ||.|:::.|.|:..:.|....:|||| |||.| ::.|..||.:|..|::.|:|::|   |..:|.
 Frog   118 SSNIQSVPLPSACASAGTNCLISGWGNTLSSG-TNYPDLLQCLNAPILTASECSNS---YPGEIT 178

  Fly   193 STMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :.|.||.  |.|||:||||||||:|..|.|.||||||||||..||||||..|....||:
 Frog   179 NNMFCAGFLAGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 96/224 (43%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 97/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.