DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Prss33

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:283 Identity:98/283 - (34%)
Similarity:139/283 - (49%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAV------ACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSN 64
            |||..|      .||..|.      |::..|||||.......:|||.|:|..|:|.||||:.:..
  Rat     9 ILLLVVLGARMQECAACGQ------PRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQ 67

  Fly    65 VIVTAAHCLQSVSASVLQIRAGSSYWS--SGGVTFSVSSFKNHE------------GYNANTMVN 115
            .::||.||.   |..||     .|.:|  .|.::..|:|  :||            .|:.:....
  Rat    68 WVLTAGHCF---SRRVL-----PSEYSVLLGALSLDVTS--SHELLVPVLRVLLPPDYSEDEARG 122

  Fly   116 DIAIIKINGALTFSSTIKAIGLAS--SNPANGAAASVSGWGTLSYGSSSIP----SQLQYVNVNI 174
            |:|:::::..::.|:.|:.:.|.:  |:|..|:...|:|||:||.|   :|    ..||.|.|.:
  Rat   123 DLALLQLSHPVSLSARIQPVCLPAPGSHPPPGSPCWVTGWGSLSPG---VPLPKGRPLQGVRVPL 184

  Fly   175 VSQSQCASSTYGYGSQIRST-------MICAA--ASGKDACQGDSGGPLV---SG-GVLVGVVSW 226
            :....| ...|..|:.:..:       .:||.  ...||||||||||||.   || .||||||||
  Rat   185 LDSRAC-DRLYHMGANVPKSERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGRWVLVGVVSW 248

  Fly   227 GYGCAYSNYPGVYADVAALRSWV 249
            |.|||..|.||||.:||....|:
  Rat   249 GKGCALPNRPGVYTNVAKYSPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 89/251 (35%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 89/251 (35%)
Tryp_SPc 34..272 CDD:238113 89/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.