DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and deltaTry

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:253 Identity:253/253 - (100%)
Similarity:253/253 - (100%) Gaps:0/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130

  Fly   131 TIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 TIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM 195

  Fly   196 ICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISNA 253
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 ICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISNA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 218/218 (100%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 218/218 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117904
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.