DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and CG7829

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:249 Identity:99/249 - (39%)
Similarity:139/249 - (55%) Gaps:16/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            ::||.|..|.       .|..:.|.|||||....|::.|:.:|:|..|.|.|||||.:::.|:||
  Fly     9 LLLLQASGCL-------SLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTA 66

  Fly    70 AHCLQSVSASVLQIR-AGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIK 133
            .|||..|...:|::: .|:|.:...|..|||:..:.||.:|..||..||.||::...||.|..:|
  Fly    67 GHCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVK 131

  Fly   134 AIGLASSNPANGAAASVSGWGTLSYGSSSIPS-QLQYVNVNIVSQSQCASSTYGYGSQIRSTMIC 197
            ||.:.....|.|..|:::|||..|....  || .|:|..|.||:|:.|.:.   .|..:...|:|
  Fly   132 AIPINPERVAEGTYATIAGWGFKSMNGP--PSDSLRYARVPIVNQTACRNL---LGKTVTDRMLC 191

  Fly   198 AA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.  ..|.||||.||||||.....|||:||||.|||.::.||||:.:.||..|:
  Fly   192 AGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 92/222 (41%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 92/221 (42%)
Tryp_SPc 28..248 CDD:238113 92/223 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.