DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and CG5246

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:130/273 - (47%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVA----CA---------------LGGTVPEGLLPQLDGRIVGGSATTISSFPWQIS 47
            :|.::|:|.:.    |:               ||...||       .|::||..:.....|:|:|
  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPE-------TRVIGGVDSPTGFAPYQVS 58

  Fly    48 LQRS-GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNAN 111
            :..: |.|.|||||.:...|:|||||:: .....|:|..|:..::..|..:.|...|.|..::..
  Fly    59 IMNTFGEHVCGGSIIAPQWILTAAHCME-WPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKP 122

  Fly   112 TMVNDIAIIKINGALTFSSTIKAIGLAS--SNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVN 173
            ...||||:|.....:.:....:.|.|||  |.|..|...:::||| |.::|..|  :|||.:::|
  Fly   123 AYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYS--TQLQKIDLN 185

  Fly   174 IVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGG-VLVGVVSWGYGCAYSNYP 236
            .:....|.|.... .:.:....:|. ...|:.:|.||||||||... .|||||:||..||. .||
  Fly   186 YIDHDNCQSRVRN-ANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACAI-GYP 248

  Fly   237 GVYADVAALRSWV 249
            .|:..||....|:
  Fly   249 DVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 75/224 (33%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/224 (33%)
Tryp_SPc 42..263 CDD:238113 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.