DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Try10

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:251 Identity:92/251 - (36%)
Similarity:136/251 - (54%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            |::|:.|..|:.....:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:|:|
  Rat     4 VLILALVGAAVAFPAAD------DDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINEQWVVSA 61

  Fly    70 AHCLQSVSASVLQIRAGSSYWS--SGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            |||.:    |.:|:|.|....:  .|...| :.:....|..:...|:.|||.:||::..:..:|.
  Rat    62 AHCYK----SRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSR 122

  Fly   132 IKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM 195
            :..:.|.||....|....:|||| |||:|.:. |..||.::..::.|:.|.:|   |..:|...|
  Rat   123 VATVALPSSCAPAGTQCLISGWGNTLSFGVNE-PDLLQCLDAPLLPQADCEAS---YPGKITDNM 183

  Fly   196 ICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :||.  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:
  Rat   184 VCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 86/224 (38%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 86/224 (38%)
Tryp_SPc 24..242 CDD:238113 87/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.