DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and CG32271

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:225 Identity:81/225 - (36%)
Similarity:132/225 - (58%) Gaps:3/225 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90
            :.:.|||||....|:|.|:.::|:..|:..||||:.:...:||||||::.:.||.:.:.||.:..
  Fly    20 EANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKGIGASRILVVAGVTRL 84

  Fly    91 SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGT 155
            :..||...|......:.||..|:.:|:|::|:...:: ...:..|.|.:::...|....|||||.
  Fly    85 TETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKAGDLIKVSGWGQ 148

  Fly   156 LSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG-KDACQGDSGGPLVSGGV 219
            ::..:.::..|::.|:|.::.:..|.|. |.....|.:||.||:..| ||||:||||||.|..|.
  Fly   149 ITERNKAVSMQVRSVDVALIPRKACMSQ-YKLRGTITNTMFCASVPGVKDACEGDSGGPAVYQGQ 212

  Fly   220 LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.|:||||.|||..:.||||.:|..:||::
  Fly   213 LCGIVSWGVGCARKSSPGVYTNVKTVRSFI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 81/219 (37%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 81/219 (37%)
Tryp_SPc 25..244 CDD:238113 80/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.