DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and PRSS41

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:266 Identity:80/266 - (30%)
Similarity:125/266 - (46%) Gaps:49/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EGLLPQLDGR------IVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQ----- 74
            |.||.:..|.      :.||..:....:|||.||:....|.||||:.|...:::||||.|     
Human    55 EELLSEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQKHYYP 119

  Fly    75 ---SVSASVL-------QIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
               :|....|       .:||.||.:....:..:..:.        ..:.||||::::..::|::
Human   120 SEWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDAL--------GVLRNDIALLRLASSVTYN 176

  Fly   130 STIKAIGLASS--NPANGAAASVSGWGTLSYGSSSIPS--QLQYVNVNIVSQSQC------ASST 184
            :.|:.|.:.||  |..:.....|:|||.:|...:.:|.  .|:...|.|::.::|      .||.
Human   177 AYIQPICIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSR 241

  Fly   185 YGYGSQIRSTMICAAA--SGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVA 243
                |.|..:|.||.|  ...|.|:||||||||  ..|:  .||:||||..|...|.||||.:::
Human   242 ----SMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNIS 302

  Fly   244 ALRSWV 249
            ....|:
Human   303 VYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 75/255 (29%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.