DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and CG17571

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:255 Identity:130/255 - (50%)
Similarity:170/255 - (66%) Gaps:11/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLD---GRIVGGSATTISSFPWQISLQRS-GSHSCGGSIY 61
            :|..|:.|.|:|.:..|.      |.||   ||||.|....|.::|:|:|:|.: |||.||||:.
  Fly     4 LLLSVVALVALAASCHGN------PGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLI 62

  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGAL 126
            .|..::|||||:||.:||.||:|.||:..||||...:|.:||.|||||:..|:||:||||::..:
  Fly    63 DSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPV 127

  Fly   127 TFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS-Q 190
            ..:|.|:||.||.|...:|..|.||||||..:...|.|..||.|.|:::....||:.||.||| .
  Fly   128 RQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDS 192

  Fly   191 IRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            |..||:||....|||||||||||||:...||||||||.|||::.|||||||||:||||::
  Fly   193 ILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 119/220 (54%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 119/220 (54%)
Tryp_SPc 31..254 CDD:238113 119/222 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443167
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.840

Return to query results.
Submit another query.