DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and PRSS38

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:268 Identity:80/268 - (29%)
Similarity:132/268 - (49%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :.|..:|||.         .|.::|:|:||.......:|||:|:..:|.|.|||||.:...:::|
Human    43 ISLTGSVACG---------RPSMEGKILGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSA 98

  Fly    70 AHCLQS----------VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNA-NTMVNDIAIIKIN 123
            |||...          |....|::....:.|      :.|:....|..|.. :.:..|:|::::.
Human    99 AHCFHRDKNIKIYDMYVGLVNLRVAGNHTQW------YEVNRVILHPTYEMYHPIGGDVALVQLK 157

  Fly   124 GALTFSSTIKAIGLASSNPANGAAAS--VSGWGTLS-YGSSSIPSQLQYVNVNIVSQSQCASSTY 185
            ..:.||.::..:.||:.. .|..:|:  .:|||.:| .|.:|  .:||.:.:.::.:..| ...|
Human   158 TRIVFSESVLPVCLATPE-VNLTSANCWATGWGLVSKQGETS--DELQEMQLPLILEPWC-HLLY 218

  Fly   186 GYGSQIRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAA 244
            |:.|.|...|:||.  .:.|..|:||||||||    ...:.:|:||||.||:...||||||.|:.
Human   219 GHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSY 283

  Fly   245 LRSWVISN 252
            ...|:..|
Human   284 FSKWICDN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 72/238 (30%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.