DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Send1

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:248 Identity:104/248 - (41%)
Similarity:142/248 - (57%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAH 71
            ||.||...:...||..|.|  ..||:|||:..|:..|||:|||..|.|.|||||||..:|:||||
  Fly     8 LLLAVHLLISPVVPVLLEP--SERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAH 70

  Fly    72 CLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIG 136
            |::....|   ||||||...||||...|.::..|..::.:.|.||:|::|::..|:||.:|:.|.
  Fly    71 CIKEGERS---IRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFSDSIQTIP 132

  Fly   137 LASSNPANGAAASVSGWGTLSYGSSSI-PSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA 200
            ||.::|...::|..:|||.   |:..| |.|||.|.:.|.....|...   ||:.:.:..|||..
  Fly   133 LAETDPPTSSSALATGWGR---GNFLIRPRQLQGVEILIRPLIVCKLK---YGNGVFNEDICAGR 191

  Fly   201 SGKDACQGDSGGPLVSGGVLVGVVS--WGYGCAYSNYPGVYADVAALRSWVIS 251
            .||..|.||||||||..|.|||:.|  ....|..|:   :||.||..|:|::|
  Fly   192 MGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSS---LYASVARYRNWILS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 94/221 (43%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 94/221 (43%)
Tryp_SPc 30..239 CDD:238113 93/220 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443216
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.