DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Ser12

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:253 Identity:109/253 - (43%)
Similarity:156/253 - (61%) Gaps:16/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            :|.:::|:::|.....|:.||        |||||....||..|||.:|..|..:.||..|||..:
  Fly     2 LLHWLVLVASVTLISAGSSPE--------RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKI 58

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV-NDIAIIKINGALTFS 129
            |:|||||::....::..:|.||.:.:.||....|:..:.||.|.::|:: ||||:|::...|.|:
  Fly    59 IITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFN 123

  Fly   130 STIKAIGLASSNPANGAAASVSGWGTLSYGSSSI-PSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193
            :.::.|.||.|.||.|..|||||||.:  |...: |:.|...:|.|:..:.|..| |.|   |..
  Fly   124 AEVRPIQLADSAPAAGTEASVSGWGEI--GILWLQPTSLLKTSVKILDPNVCKRS-YQY---ITK 182

  Fly   194 TMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            |||||||..||:|.|||||||||||.|||:||:|.|||...:|||||:||.|:.|:::
  Fly   183 TMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 102/220 (46%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 102/220 (46%)
Tryp_SPc 24..238 CDD:238113 101/219 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443219
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.