DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and CG31267

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:231 Identity:76/231 - (32%)
Similarity:124/231 - (53%) Gaps:8/231 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRS-GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS-S 88
            :...|||||..:.:.:.|:.:|||.: |:|.|.|||.....::|||.||..:..:.:|:...: :
  Fly    40 KFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYN 104

  Fly    89 YWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLAS-SNPANGAAASVSG 152
            :|.|.|..:||.....|..:::....||||:||.:....:....:.|.:|. .:..:|...::.|
  Fly   105 HWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYG 169

  Fly   153 WGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAAS-GKDACQGDSGGPLV- 215
            :|:...| .....|||.::|..|:..:| ::|||....:....:||... |..||.||:|||:| 
  Fly   170 YGSTEIG-GDFSWQLQQLDVTYVAPEKC-NATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVD 232

  Fly   216 SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            |.|.||||.:||..|.| .:|.|:|.::...||:||
  Fly   233 SRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWIIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 73/223 (33%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 73/223 (33%)
Tryp_SPc 45..268 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.