DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Klk15

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:269 Identity:85/269 - (31%)
Similarity:126/269 - (46%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSN 64
            :|.||:|:||..               || :::.|......|.|||::|...|..:||..:.|..
Mouse     4 LLAFVLLVSAAQ---------------DGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPR 53

  Fly    65 VIVTAAHCLQSVSASVLQIRAGS---SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGAL 126
            .::|||||    ....:::|.|.   ..:.......|||....|.||.|.|..:||.::::....
Mouse    54 WVLTAAHC----QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPA 114

  Fly   127 TFSSTIKAIGLASSNPANGAAASVSGWGTLS------YGSSS----IPSQLQYVNVNIVSQSQCA 181
            ..::.::.:.|....|..|....|||||.||      .||..    :|..|...|::|:|::.|.
Mouse   115 RLTAYVRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCN 179

  Fly   182 SSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVA 243
            ..   |..::..||:||.  ..|.|:|:||||||||.||.|.|:|||| ..|..:..||||..|.
Mouse   180 KD---YPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVC 241

  Fly   244 ALRSWVISN 252
            :...|:..|
Mouse   242 SYLEWIWEN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 75/234 (32%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.