DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Prtn3

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:237 Identity:69/237 - (29%)
Similarity:112/237 - (47%) Gaps:33/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRS---GSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWS 91
            :||||......|.|:..|||.|   |||.|||::.....::|||||||.:|..::.:..|:....
  Rat   197 KIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLL 261

  Fly    92 SG---GVTFSVSS-FKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNP--ANGAAASV 150
            |.   ...|:::. |:|:  ||....:||:.::::|...:....:....|...:.  :.|.....
  Rat   262 SSEPEQQKFTITQVFENN--YNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLA 324

  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVS-----QSQCASSTYGYGSQIRSTMICAAASGKDACQGDS 210
            .|||.|...:.: |..|..:||.:|:     .:.|             |::...|:|  .|.|||
  Rat   325 MGWGRLGTRAPT-PRVLHELNVTVVTFLCREHNVC-------------TLVPRRAAG--ICFGDS 373

  Fly   211 GGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSWVIS 251
            ||||:..|:|.||.|:.. .||...:|..:|.|:...:|:.|
  Rat   374 GGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 67/233 (29%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.