DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and LOC312273

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:238 Identity:92/238 - (38%)
Similarity:122/238 - (51%) Gaps:14/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVL 81
            |||........|.|||||......|.|:|:|| .:|||.||||:.:...:::||||..    ..|
  Rat    11 GTVAAFPTEDNDDRIVGGYTCQEHSVPYQVSL-NAGSHICGGSLITDQWVLSAAHCYH----PQL 70

  Fly    82 QIRAG--SSYWSSGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA 143
            |:|.|  :.|...|...| ..:....|..|:..|:.|||.:||:....|.:|.:..|.|....|.
  Rat    71 QVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQYCPT 135

  Fly   144 NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDAC 206
            .|....|||||.|.:|..| ||.||.::..::|.|.|..:   |..||.:.|.|..  ..|||:|
  Rat   136 AGTECLVSGWGVLKFGFES-PSVLQCLDAPVLSDSVCHKA---YPRQITNNMFCLGFLEGGKDSC 196

  Fly   207 QGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.|||||:|..|.:.|:||||.|||....||||..|....:|:
  Rat   197 QYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 87/223 (39%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 87/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.