DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Klk9

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:255 Identity:78/255 - (30%)
Similarity:115/255 - (45%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            ::|.|.:|...|.          |.|.||......:|.|||..|.......||.::.:...::||
  Rat     7 LVLFSLLAGHCGA----------DTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTA 61

  Fly    70 AHCLQSVSASVLQIRAGSSY---WSSGGVTFSVSSFKNHEGYN----ANTMVNDIAIIKINGALT 127
            |||.:    ..|.:|.|..:   |........|:.|..|.|:|    ||...:||.:|::...:.
  Rat    62 AHCRK----PYLWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVR 122

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            .|..::.:.|:.|.|:.|....:||||::|......|..||..|::|:....|   .:.|...|.
  Rat   123 LSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLC---RWAYPGHIS 184

  Fly   193 STMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            ..|:||.  ..|:.:||||||||||..|.|.|:||.| ..|:....|.||..|.....|:
  Rat   185 EKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 72/228 (32%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.