DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Klk13

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:260 Identity:79/260 - (30%)
Similarity:122/260 - (46%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVAC---ALGGTVPEGLLPQLDGR------IVGGSATTISSFPWQISLQRSGSHSCGGSIYS 62
            |::.:||   ||.|.:.......|:|.      :.||......|.|||.:|...|...|||.:..
  Rat     4 LVATIACLTLALSGGISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAALLVRGRLLCGGVLVH 68

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVN---DIAIIKING 124
            ...::|||||.:......|...|.....:.......|.|..:.|...:.|.:|   ||.::::..
  Rat    69 PKWVLTAAHCRKDGYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQVSPTHLNHDHDIMLLELKS 133

  Fly   125 ALTFSSTIKAIGLASSN--PANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            .:..|:.::.:.|::.:  | .|....||||||.:....:.|..||..|:.:.|..:|...   |
  Rat   134 PVQLSNHVRTLQLSADDCLP-TGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECRQV---Y 194

  Fly   188 GSQIRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            ..:|.:.|:||..  .|||:|:|||||||:..|.|.|::||| :.|...|.||||..|:....|:
  Rat   195 PGKITANMLCAGTKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQPNRPGVYTRVSKYLRWI 259

  Fly   250  249
              Rat   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 70/232 (30%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 71/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.