DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Prss34

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:278 Identity:96/278 - (34%)
Similarity:135/278 - (48%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLP----QLDGRIVGGSATTISSFPWQISLQ------RSGSHS 55
            ||.|:.|  .:.| ||.|:|  |.|    :|.| ||||...:.|.||||:||:      ....|.
  Rat     5 MLWFLFL--TLPC-LGSTMP--LTPDSGQELVG-IVGGCPVSASRFPWQVSLRFYNMKLSKWEHI 63

  Fly    56 CGGSIYSSNVIVTAAHC--LQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV---N 115
            ||||:.....::|||||  |:.:.||..:::.|............|:....|..::.....   .
  Rat    64 CGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGA 128

  Fly   116 DIAIIKINGALTFSSTIKAIGL--ASSNPANGAAASVSGWGTLSYGSSSI--PSQLQYVNVNIVS 176
            |||::|::..:..|..:..:.|  ||...::.....|:|||.:. |...:  |..|:.|.|.||.
  Rat   129 DIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVIE-GHRPLPPPCHLREVAVPIVG 192

  Fly   177 QSQCASSTYGYGSQIRST------MICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCA 231
            .|.|......|.|..|:|      |:||...|:|:||.|||||||    ...|.|||||||.||.
  Rat   193 NSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCG 257

  Fly   232 YSNYPGVYADVAALRSWV 249
            ..::||||..|.:..||:
  Rat   258 LPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 82/243 (34%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 83/244 (34%)
Tryp_SPc 33..275 CDD:214473 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.