DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and KLK9

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:232 Identity:74/232 - (31%)
Similarity:108/232 - (46%) Gaps:17/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSY--- 89
            |.|.:|......:|.|||..|.......||.::.|...::|||||.:    ..|.:|.|..:   
Human    20 DTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRK----PYLWVRLGEHHLWK 80

  Fly    90 WSSGGVTFSVSSFKNHEGYN----ANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASV 150
            |......|.|:.|..|.|:|    ||...:||.:|::......|..::.:.|:.:..:.|....:
Human    81 WEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLI 145

  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGP 213
            ||||.:|...:..|..||..|::|:....|   .:.|...|..:|:||.  ..|:.:||||||||
Human   146 SGWGAVSSPKALFPVTLQCANISILENKLC---HWAYPGHISDSMLCAGLWEGGRGSCQGDSGGP 207

  Fly   214 LVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            ||..|.|.||||.| ..|:....|.||..|.....|:
Human   208 LVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 72/228 (32%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.