DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Tpsg1

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:263 Identity:95/263 - (36%)
Similarity:127/263 - (48%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLL-----------PQLD---GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIV 67
            |..|:.|.           ||:.   .|||||.|....::|||.||:....|.||||:.|...::
Mouse    59 GQYPDSLANSVSSGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVL 123

  Fly    68 TAAHCLQ-SVSASVLQIRAGSSYWSSGGVTFS--VSSFKNHEGYNANT----MVNDIAIIKINGA 125
            |||||.. ||::|..|:..|..     .||.|  .|:.|....|..:.    ...|||:::::..
Mouse   124 TAAHCFSGSVNSSDYQVHLGEL-----TVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSP 183

  Fly   126 LTFSSTIKAIGL--ASSNPANGAAASVSGWGTLSYGSS-SIPSQLQYVNVNIVSQSQCASSTYG- 186
            :..||.::.:.|  ||::...|....|:|||....|.. ..|..||...|::|....| |..|. 
Mouse   184 VALSSQVQPVCLPEASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTC-SQAYNS 247

  Fly   187 -YGSQIRSTMICAAASGKDACQGDSGGPLVS--GGV--LVGVVSWGYGCAYSNYPGVYADVAALR 246
             .||.|:..|:||...| ||||.|||||||.  .|.  ..||||||.||...:.|||||.|.|..
Mouse   248 PNGSLIQPDMLCARGPG-DACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYV 311

  Fly   247 SWV 249
            :|:
Mouse   312 NWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 89/234 (38%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 89/235 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.