DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and Prss8

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:239 Identity:85/239 - (35%)
Similarity:128/239 - (53%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL-QSVSASVLQIRAGS---SYW 90
            ||.||.:.....:|||:|:..:|.|.||||:.|:..:|:||||. :..|....:::.|:   ..:
  Rat    44 RITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSF 108

  Fly    91 SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAASVSGW 153
            |:..|..:|:...:|..|.......|||:|:::..:|||..|:.|.|.::|.:  ||...:|:||
  Rat   109 SNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGW 173

  Fly   154 GTLSYG-SSSIPSQLQYVNVNIVSQSQCASSTYGYGS------QIRSTMICA--AASGKDACQGD 209
            |.::.. |...|..||.:.|.::|:..| |..|...:      .|:..|:||  ...||||||||
  Rat   174 GHVAPSVSLQTPRPLQQLEVPLISRETC-SCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGD 237

  Fly   210 SGGPL---VSG-GVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||||   :.| ..|.|:||||..|...|.||||...:...||:
  Rat   238 SGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 84/237 (35%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 84/237 (35%)
Tryp_SPc 45..284 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.