DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and zgc:171509

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:261 Identity:84/261 - (32%)
Similarity:120/261 - (45%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68
            |::|:..|..:.|            .:|:||......|.|||..|. .|...||||:...:.:|:
Zfish     6 FILLIGVVVHSKG------------DKIIGGHECQPHSQPWQARLD-DGYGLCGGSLIHESWVVS 57

  Fly    69 AAHCLQS-------------VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAII 120
            ||||..|             |..:..:|:|              ....:|..||.....|||.:|
Zfish    58 AAHCKSSSIIVHLGKHDLFVVEDTAQEIQA--------------EKVISHPKYNNREHNNDIMLI 108

  Fly   121 KINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTY 185
            |:......::.:|.:.|.::....|....|||||..   ..||.|.||.:.:.|:|::.|.|:  
Zfish   109 KLREPAVINNNVKPVPLPTNCSHAGEQCLVSGWGVT---GDSISSTLQCLELPILSKADCKSA-- 168

  Fly   186 GYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSW 248
             ||..|...|.||.  ..|||:||||||||:|..|.|.|:||:|.|||...:||||.:|....:|
Zfish   169 -YGRVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYINW 232

  Fly   249 V 249
            :
Zfish   233 I 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 79/233 (34%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 79/233 (34%)
Tryp_SPc 21..234 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.