DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30031 and gzm3.4

DIOPT Version :9

Sequence 1:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:258 Identity:74/258 - (28%)
Similarity:116/258 - (44%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :||:|......||         ::..||||....:.|.|:..|||....|:|||.:...:.::|:
Zfish     8 IILISYSVIKTGG---------MESGIVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTS 63

  Fly    70 AHCLQSVSASVLQIRAGS---SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131
            |||.:..:.  |::..|:   |...:......|..:..|..|.......||.::|:......:..
Zfish    64 AHCWKDTTN--LEVVLGAHNISQRENSQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHF 126

  Fly   132 IKAIGLASSNPANGA--AASVSGWGTL--SYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            :....|....|:..|  ..|::|||..  ..|:|::   |:.||:.:.|.|.|.|....|.:.  
Zfish   127 VNITNLPKHEPSILAPVECSIAGWGMQRPGEGASNV---LREVNLQLESNSYCKSKWQVYFNS-- 186

  Fly   193 STMICAAASGKDA-CQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPGVYADVAALRSWVISN 252
            ..|:|.|:.||.| ||||||.||.....|.|:.::.|  .|.:..||.||..|:|...|:..|
Zfish   187 KNMVCTASDGKKAFCQGDSGSPLFCNSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWIKKN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 67/228 (29%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 68/230 (30%)
Tryp_SPc 25..246 CDD:214473 67/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.