DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30026 and CG6912

DIOPT Version :9

Sequence 1:NP_725049.3 Gene:CG30026 / 246399 FlyBaseID:FBgn0050026 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_650419.1 Gene:CG6912 / 41820 FlyBaseID:FBgn0038290 Length:433 Species:Drosophila melanogaster


Alignment Length:353 Identity:85/353 - (24%)
Similarity:113/353 - (32%) Gaps:166/353 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FFIATATWAQDTRPEVPIYLPPPSITTTTTEAPVTTTITEEPTTESLTTTTTETSSTFSTTEPAA 73
            :|::.......|.||.   .|..|.|||||   .|||.|.||||   ||||.|.::|.:||||..
  Fly    73 YFLSIDELCYRTNPEP---CPLESTTTTTT---TTTTTTTEPTT---TTTTAEPTTTTTTTEPTT 128

  Fly    74 TTTT--EISTTSTTEPSTTTLTTKKIPSTTTAI-------------------------------- 104
            ||||  ..:||:||||:|||.||...|...|.:                                
  Fly   129 TTTTTEPTTTTTTTEPTTTTTTTTTAPPVITELTRCPPGSIYFDSQCRKIVCSEGEYKAGRCISL 193

  Fly   105 ------------------ITT---------------------TGVETSTTT------------TT 118
                              |||                     ..||..|:.            |.
  Fly   194 ACPAGTVWYQKRCQQPGFITTILEIDNVIHNEHKYSVTSENINRVEYITSAPYDPDNDKSYDYTI 258

  Fly   119 ETTTASTTQGDP-IYPTYRPPYMRPSTSGIPPVSSTNPWIWNNGNPAVKCYLRNQQEYRSDCYGV 182
            :...|:||...| |||:     :||||.    .|:.|........|...|::::.:    .|  :
  Fly   259 DNIVATTTTRRPWIYPS-----LRPSTE----QSAANEVFPGRHPPPQCCFVKSPR----IC--I 308

  Fly   183 GWHPTTIC---------YRCC------------YYDQN--RI----------------------- 201
            .:.|..:|         .|.|            .||:|  |:                       
  Fly   309 NYAPNWVCSNKENKFCDSRVCTAPVVYLKPPKVVYDENAKRVVMPPNPPLLACSTPDCKESDILD 373

  Fly   202 -AGCSKIHRGRCSWYDYARWISPNFYVY 228
             :||....|.:|         ||..|.|
  Fly   374 CSGCKDHQRDKC---------SPGCYSY 392



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYII
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.