Sequence 1: | NP_725049.3 | Gene: | CG30026 / 246399 | FlyBaseID: | FBgn0050026 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572179.1 | Gene: | CG15473 / 31401 | FlyBaseID: | FBgn0029719 | Length: | 714 | Species: | Drosophila melanogaster |
Alignment Length: | 170 | Identity: | 48/170 - (28%) |
---|---|---|---|
Similarity: | 64/170 - (37%) | Gaps: | 58/170 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 DTRPEVPIYLPPPSITTTTTEAPVTTTITEEPTTESLTTTTTETSSTFSTTEPAATTTTEISTTS 83
Fly 84 TTEPSTTTL----TTKKIP---STTTAIITTTGVE--------------------------TSTT 115
Fly 116 TTTETTTASTTQGDPIYPTYRPPYMRPSTSGIPPVSSTNP 155 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2CYII | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |