DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30026 and CG15473

DIOPT Version :9

Sequence 1:NP_725049.3 Gene:CG30026 / 246399 FlyBaseID:FBgn0050026 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_572179.1 Gene:CG15473 / 31401 FlyBaseID:FBgn0029719 Length:714 Species:Drosophila melanogaster


Alignment Length:170 Identity:48/170 - (28%)
Similarity:64/170 - (37%) Gaps:58/170 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DTRPEVPIYLPPPSITTTTTEAPVTTTITEEPTTESLTTTTTETSSTFSTTEPAATTTTEISTTS 83
            :.||.|.:..|..|   ||..||           .|...|||||:||..:|....||.....:||
  Fly   523 EQRPVVSLEQPELS---TTVSAP-----------SSNAGTTTETASTERSTHVIPTTIASFVSTS 573

  Fly    84 TTEPSTTTL----TTKKIP---STTTAIITTTGVE--------------------------TSTT 115
            |......::    ||.||.   ||||.  |:|..|                          .|||
  Fly   574 THFSPLRSISRYRTTPKITAGRSTTTT--TSTSTEPPLNKWAKRRKEQDSKAKSSHRHEAFVSTT 636

  Fly   116 TTTETTTASTTQGDPIYPTYRPPYMRPSTSGIPPVSSTNP 155
            ::|.|||::|.         .||....:::|:|..|...|
  Fly   637 SSTSTTTSTTA---------TPPSTIAASTGVPLASPLPP 667



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYII
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.