DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Klk12

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:260 Identity:85/260 - (32%)
Similarity:127/260 - (48%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLD-GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            ::|.|||  :.||:|       |.|.| .:|..|.....:|.|||:.|.......|||.:.....
Mouse     1 MRFSILL--LLCAVG-------LSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKW 56

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSS--GGVTFSVS------SFKNHEGYNANTMVNDIAIIKI 122
            ::|||||.......:.:.......|:.  ...|||::      :::|||        :|:.::::
Mouse    57 VLTAAHCRDKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHE--------HDLRLLRL 113

  Fly   123 NGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            |..:..:..::.:.|.||....||...||||||.:......|.:||.:|::.||...|.:.   :
Mouse   114 NRPIHLTRAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAV---F 175

  Fly   188 GSQIRSTMICAAA-SGKDACQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPGVYADVAALRSWV 249
            ..::...|:||.. :||||||||||||||.||||.|:||||.  .|.....||||..|.....|:
Mouse   176 PGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

  Fly   250  249
            Mouse   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 74/229 (32%)
Tryp_SPc 31..252 CDD:238113 75/230 (33%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.