DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and zgc:123295

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:266 Identity:100/266 - (37%)
Similarity:151/266 - (56%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALG--GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRS--GSHSCGGSIYSSNV 65
            ::.::...|.|.  |..|      |:.:||||......|:|||:|||..  |.|.||||:.:.:.
Zfish    14 LVNIAGSLCQLNVCGRAP------LNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDW 72

  Fly    66 IVTAAHCLQSVSASV-----LQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGA 125
            :::||||.|....::     ||.::||:.:.   :|.:|....||..||..:..||||::|::.:
Zfish    73 VLSAAHCFQDSIGTIMVKLGLQSQSGSNPYQ---ITKTVVQVINHPNYNNPSNDNDIALVKLDSS 134

  Fly   126 LTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYG 188
            :||:..|:.:.||::..  |.|..:.|:|||.||..::.||..||.|.:.|||.|.|..:   |.
Zfish   135 VTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRA---YP 196

  Fly   189 SQIRSTMICAA---ASGKDACQGDSGGPLVSGG----VLVGVVSWGYGCAYSNYPGVYADVAALR 246
            .:|.|.||||.   ..|||:||||||||:||..    :..|:||:|.|||...||||||.|:..:
Zfish   197 GEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQ 261

  Fly   247 SWVINN 252
            .|:.::
Zfish   262 DWITSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 94/234 (40%)
Tryp_SPc 31..252 CDD:238113 95/236 (40%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 94/234 (40%)
Tryp_SPc 36..264 CDD:238113 94/233 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.