DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and PRSS22

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:274 Identity:97/274 - (35%)
Similarity:139/274 - (50%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLL---PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            ::||::.|......:|....   ||...|:|||..:|.|.:||.:|:|::|:|.|.||:.:|..:
Human    21 LLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWV 85

  Fly    67 VTAAHC---------LQSVSASVLQIRAGSSYWSSGGVTF----SVSSFKNHEGYNANTMVNDIA 118
            :|||||         |.||.....|:....|.....||.:    .|.|:|  ||..|     |||
Human    86 ITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWK--EGACA-----DIA 143

  Fly   119 IIKINGALTFSSTIKAIGLASSN---PANGAAASVSGWGTLSYG-SSSIPSQLQYVNVNIVSQSQ 179
            ::::..::.||..:..|.|..::   |.| ....:||||::..| ....|..||.:.|.|:....
Human   144 LVRLERSIQFSERVLPICLPDASIHLPPN-THCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEV 207

  Fly   180 CASSTYGYGS---QIRSTMICAA--ASGKDACQGDSGGPL---VSGG-VLVGVVSWGYGCAYSNY 235
            | |..|..|:   .|...|:||.  ...:|||.|||||||   |.|. :|.|::|||.|||..|.
Human   208 C-SHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNR 271

  Fly   236 PGVYADVAALRSWV 249
            ||||..::|.||||
Human   272 PGVYISLSAHRSWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 89/244 (36%)
Tryp_SPc 31..252 CDD:238113 90/245 (37%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 90/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.