DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG17242

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:253 Identity:84/253 - (33%)
Similarity:127/253 - (50%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQL--DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSS 63
            :||.::||.::|             |:  |.:.:|     |...|||.|:|.:..|.|||.|||.
  Fly     2 LLKGILLLVSIA-------------QIAADFKSIG-----IEQAPWQASVQINDKHHCGGVIYSE 48

  Fly    64 NVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTF 128
            ::|:|.|.|::......:.:|.||:..::||....|...:...   .....:|:||:::...|..
  Fly    49 DIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQV---LGLRPSDVAILQLRSPLYL 110

  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193
            ...|:||.||:.....|..|||||||.||..:.|....|: |:|.|..|..||::....|..:..
  Fly   111 DGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLR-VDVKIQDQLMCATNLALKGRLMSV 174

  Fly   194 TMICAAASGK--DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ..||||.:|:  .||||..|||||:...|.|::||...|...|...|||::|..:.|:
  Fly   175 GEICAAPAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 76/220 (35%)
Tryp_SPc 31..252 CDD:238113 77/221 (35%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 76/213 (36%)
Tryp_SPc 24..232 CDD:214473 75/211 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.